CHST10 Peptide - C-terminal region
CHST10 Peptide - C-terminal region
Product Specifications
Product Name Alternative
CHST10
UniProt
O43529
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with CHST10 Rabbit Polyclonal Antibody (orb588052) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
XP_005264131
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: YRHEIAPGIIRKYRRNRTETRGIQFEDFVRYLGDPNHRWLDLQFGDHIIH
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC941214-100 1x 100 µL
Luteinizing Hormone beta (LH beta) (LHb/1214), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
DY350-4601-1 1 mg
Dylight 350 Conjugated Vicia villosa Lectin (Hairy Vetch) -VVA-
Sign In for Pricing
View Details 
![PARN Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2D9]](https://cdn.genprice.uk/products/937/68dd1b78061270361ea1b2df/imageurl/ta802721bm.webp)
TA802721BM 100 µL
PARN Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2D9]
Sign In for Pricing
View Details 
BNC401409-500 1x 500 µL
MART-1 / Melan-A / MLANA (Melanoma Marker) (MLANA/1409R), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details