CHST10 Peptide - C-terminal region
CHST10 Peptide - C-terminal region
Product Specifications
Product Name Alternative
CHST10
UniProt
O43529
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with CHST10 Rabbit Polyclonal Antibody (orb588052) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
XP_005264131
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: YRHEIAPGIIRKYRRNRTETRGIQFEDFVRYLGDPNHRWLDLQFGDHIIH
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC682291-500 1x 500 µL
CFTR (Cystic Fibrosis Transmembrane Conductance Regulator) (rCFTR/1342), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details ![[Leu5]-Enkephalin Acetate](https://cdn.genprice.uk/products/572/1843286267622/imageurl/trc-l330340-25mg.webp)
BNC472765-100 1x 100 µL
RAD51 (Prognostic and Response to Chemotherapy Marker) (RAD51/2765), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details