Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LRCH1 Peptide - middle region

LRCH1 Peptide - middle region

Product Specifications

Product Name Alternative

LRCH1, CHDC1, KIAA1016

UniProt

Q9Y2L9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with LRCH1 Rabbit Polyclonal Antibody (orb588055) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_055931

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LHQHVEDGKKDSDSGVGSDNGDKRLSATEPSDEDTVSLNVPMSNIMEEEQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

UBXN1 antibody
70R-21134 50 μL

UBXN1 antibody

Sign In for Pricing
View Details
HRP2 (HDGFRP2) (NM_032631) Human Over-expression Lysate
E45H17384-2 20 µg

HRP2 (HDGFRP2) (NM_032631) Human Over-expression Lysate

Sign In for Pricing
View Details
ECH1 (B-3) Alexa Fluor® 546
sc-515270 AF546 200 µg/mL

ECH1 (B-3) Alexa Fluor® 546

Sign In for Pricing
View Details
SAA1 Rabbit Polyclonal Antibody
orb511407 100 µg

SAA1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Kallikrein Inhibitor Peptide, KKI-7
MBS659392-01 1 mg

Kallikrein Inhibitor Peptide, KKI-7

Sign In for Pricing
View Details
Kallikrein Inhibitor Peptide, KKI-7
MBS659392-02 5x 1 mg

Kallikrein Inhibitor Peptide, KKI-7

Sign In for Pricing
View Details