Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LRCH1 Peptide - middle region

LRCH1 Peptide - middle region

Product Specifications

Product Name Alternative

LRCH1, CHDC1, KIAA1016

UniProt

Q9Y2L9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with LRCH1 Rabbit Polyclonal Antibody (orb588055) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_055931

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LHQHVEDGKKDSDSGVGSDNGDKRLSATEPSDEDTVSLNVPMSNIMEEEQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

USH1C (NM_153676) Human Untagged Clone
SC306638 10 µg

USH1C (NM_153676) Human Untagged Clone

Sign In for Pricing
View Details
VNN3 (Vascular Non-inflammatory Molecule 3, Vanin-3, HSA238982) (MaxLight 550)
MBS6214751-01 0.1 mL

VNN3 (Vascular Non-inflammatory Molecule 3, Vanin-3, HSA238982) (MaxLight 550)

Sign In for Pricing
View Details
VNN3 (Vascular Non-inflammatory Molecule 3, Vanin-3, HSA238982) (MaxLight 550)
MBS6214751-02 5x 0.1 mL

VNN3 (Vascular Non-inflammatory Molecule 3, Vanin-3, HSA238982) (MaxLight 550)

Sign In for Pricing
View Details
BHMT2 CRISPR All-in-one AAV vector set (with saCas9)(Rat)
13317156 3x 1.0 µg DNA

BHMT2 CRISPR All-in-one AAV vector set (with saCas9)(Rat)

Sign In for Pricing
View Details
Anti-KMO Antibody Picoband® Fluoro647 Conjugated
A05469-3-Fluoro647 100 µg/Vial

Anti-KMO Antibody Picoband® Fluoro647 Conjugated

Sign In for Pricing
View Details
4- (Butylamino) -1-butanol
sc-486273 25 mL

4- (Butylamino) -1-butanol

Sign In for Pricing
View Details