TAOK1 Peptide - middle region
TAOK1 Peptide - middle region
Product Specifications
Product Name Alternative
TAOK1, KIAA1361, MAP3K16, MARKK
UniProt
Q7L7X3
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with TAOK1 Rabbit Polyclonal Antibody (orb588061) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: SDDKSELDMMEGDHTVMSNSSVIHLKPEEENYREEGDPRTRASDPQSPPQ
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
orb2833586-01 20 µg
Recombinant Human TWIST2 Protein, N-His-SUMO & C-Strep
Sign In for Pricing
View Details orb2833586-02 50 µg
Recombinant Human TWIST2 Protein, N-His-SUMO & C-Strep
Sign In for Pricing
View Details orb2833586-03 100 µg
Recombinant Human TWIST2 Protein, N-His-SUMO & C-Strep
Sign In for Pricing
View Details 
MBS6450018-01 0.1 mL
TRAPPC10 (Trafficking Protein Particle Complex Subunit 10, Epilepsy Holoprosencephaly Candidate 1 Protein, EHOC1, EHOC-1, Trafficking Protein Particle Complex Subunit TMEM1, TMEM1, GT334, TRS30, TRS130) (MaxLight 490)
Sign In for Pricing
View Details MBS6450018-02 5x 0.1 mL
TRAPPC10 (Trafficking Protein Particle Complex Subunit 10, Epilepsy Holoprosencephaly Candidate 1 Protein, EHOC1, EHOC-1, Trafficking Protein Particle Complex Subunit TMEM1, TMEM1, GT334, TRS30, TRS130) (MaxLight 490)
Sign In for Pricing
View Details