Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AATK Peptide - C-terminal region

AATK Peptide - C-terminal region

Product Specifications

Product Name Alternative

AATK, AATYK, KIAA0641, LMR1, LMTK1

UniProt

Q6ZMQ8

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with AATK Rabbit Polyclonal Antibody (orb588062) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: APNRPQQADGSPNGSTAEEGGGFAWDDDFPLMTAKAAFAMALDPAAPAPA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Myometrium
CS800207 5x 5 µm

Tissue FFPE Sections, Myometrium

Sign In for Pricing
View Details
Nucleobindin 1 (NUCB1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1A5]
TA503868AM 100 µL

Nucleobindin 1 (NUCB1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1A5]

Sign In for Pricing
View Details
HDAC11 (NM_024827) Human Over-expression Lysate
LY403040 100 µg

HDAC11 (NM_024827) Human Over-expression Lysate

Sign In for Pricing
View Details
Polystyrene A HMPA
HA140015.5G 5 g

Polystyrene A HMPA

Sign In for Pricing
View Details
Scn5a Mouse Gene Knockout Kit (CRISPR)
KN515388 1 Kit

Scn5a Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human FBXO47 activation kit by CRISPRa
GA118588 1 Kit

Human FBXO47 activation kit by CRISPRa

Sign In for Pricing
View Details