Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

WDR66 Peptide - middle region

WDR66 Peptide - middle region

Product Specifications

Product Name Alternative

WDR66

UniProt

Q8TBY9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with WDR66 Rabbit Polyclonal Antibody (orb325777) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DLSTQIEFLDLDQISPEEQQISSPERQPSGELEEKTDRMPQDELGQERRD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cd3e Hamster Monoclonal Antibody [Clone ID: 145-2C11]
CL001F 100 µg

Cd3e Hamster Monoclonal Antibody [Clone ID: 145-2C11]

Sign In for Pricing
View Details
CD200 (NM_005944) Human Over-expression Lysate
LC401799 20 µg

CD200 (NM_005944) Human Over-expression Lysate

Sign In for Pricing
View Details
Tissue Total RNA, Unknown tissue
CR562602 5 µg

Tissue Total RNA, Unknown tissue

Sign In for Pricing
View Details
DPF2 Antibody
KC-32134-01 50 μL

DPF2 Antibody

Sign In for Pricing
View Details
DPF2 Antibody
KC-32134-02 100 µL

DPF2 Antibody

Sign In for Pricing
View Details
DPF2 Antibody
KC-32134-03 1 mL

DPF2 Antibody

Sign In for Pricing
View Details