Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

WDR66 Peptide - middle region

WDR66 Peptide - middle region

Product Specifications

Product Name Alternative

WDR66

UniProt

Q8TBY9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with WDR66 Rabbit Polyclonal Antibody (orb325777) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DLSTQIEFLDLDQISPEEQQISSPERQPSGELEEKTDRMPQDELGQERRD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

(S)-(-)-Dropropizine
TRC-D681500-50MG 50 mg

(S)-(-)-Dropropizine

Sign In for Pricing
View Details
Tissue Total RNA, Colon: left
CR562550 5 µg

Tissue Total RNA, Colon: left

Sign In for Pricing
View Details
HSP60 (Heat Shock Protein 60) (Mitochondrial Marker) (HSPD1/2206R), CF568 conjugate, 0.1mg/mL
BNC682206-100 1x 100 µL

HSP60 (Heat Shock Protein 60) (Mitochondrial Marker) (HSPD1/2206R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MRPL45 (NM_001278279) Human Tagged ORF Clone
RG236984 10 µg

MRPL45 (NM_001278279) Human Tagged ORF Clone

Sign In for Pricing
View Details
Tissue FFPE Sections, Urinary bladder
CS808118 5x 5 µm

Tissue FFPE Sections, Urinary bladder

Sign In for Pricing
View Details
HuR Antibody
KC-20887-01 50 μL

HuR Antibody

Sign In for Pricing
View Details