DENND5B Peptide - middle region
DENND5B Peptide - middle region
Product Specifications
Product Name Alternative
DENND5B
UniProt
Q6ZUT9
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with DENND5B Rabbit Polyclonal Antibody (orb581824) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: ILPASLLHFLDAPVPYLMGLQSKEGTDRSKLELPQEANLCFVDIDNHFIE
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
PLU-H5228-1mg 1 mg
Human PLAU / uPA Protein, His Tag (activated by trypsin) (active enzyme)
Sign In for Pricing
View Details 
D6630 96 Tests
GDP-fucose protein O-fucosyltransferase 2 (POFUT2) Human ELISA Kit
Sign In for Pricing
View Details