Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DENND5B Peptide - middle region

DENND5B Peptide - middle region

Product Specifications

Product Name Alternative

DENND5B

UniProt

Q6ZUT9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DENND5B Rabbit Polyclonal Antibody (orb581824) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ILPASLLHFLDAPVPYLMGLQSKEGTDRSKLELPQEANLCFVDIDNHFIE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bilirubin Auto Direct, DCA
D96543 5x 100 mL (500 mL)

Bilirubin Auto Direct, DCA

Sign In for Pricing
View Details
ErbB3/Her3 Overexpression Lysate (Native) - (Dry Ice)
NBP2-09102 0.1 mg

ErbB3/Her3 Overexpression Lysate (Native) - (Dry Ice)

Sign In for Pricing
View Details
CD90 (THY1) Human qPCR Primer Pair (NM_006288)
HP209259 200 Reactions

CD90 (THY1) Human qPCR Primer Pair (NM_006288)

Sign In for Pricing
View Details
Relaxed pHOT-1 DNA
TG2035-4 500 µg

Relaxed pHOT-1 DNA

Sign In for Pricing
View Details
Rabbit anti-Schizosaccharomyces pombe (strain 972/24843)(Fission yeast) UBC4 Polyclonal Antibody
MBS7159675 Inquire

Rabbit anti-Schizosaccharomyces pombe (strain 972/24843)(Fission yeast) UBC4 Polyclonal Antibody

Sign In for Pricing
View Details
RutF Antibody
orb828955 2 mg

RutF Antibody

Sign In for Pricing
View Details