Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LRRTM3 Peptide - middle region

LRRTM3 Peptide - middle region

Product Specifications

Product Name Alternative

LRRTM3, UNQ803/PRO1693

UniProt

Q86VH5

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with LRRTM3 Rabbit Polyclonal Antibody (orb586388) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QLQQRSLMRRHRKKKRQSLKQMTPSTQEFYVDYKPTNTETSEMLLNGTGP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FGA (Fibrinogen alpha Chain) (MaxLight 550)
126756-ML550 100 µL

FGA (Fibrinogen alpha Chain) (MaxLight 550)

Sign In for Pricing
View Details
Monkey Anti trypsin ELISA kit
GTR10431354 96 Well

Monkey Anti trypsin ELISA kit

Sign In for Pricing
View Details
ACP5 ELISA Kit (Human)
OKEH00663-96W 96 Well

ACP5 ELISA Kit (Human)

Sign In for Pricing
View Details
DBH Polyclonal Antibody
BT-AP02507-01 20 µL

DBH Polyclonal Antibody

Sign In for Pricing
View Details
DBH Polyclonal Antibody
BT-AP02507-02 50 µL

DBH Polyclonal Antibody

Sign In for Pricing
View Details
DBH Polyclonal Antibody
BT-AP02507-03 100 µL

DBH Polyclonal Antibody

Sign In for Pricing
View Details