Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LRRTM3 Peptide - middle region

LRRTM3 Peptide - middle region

Product Specifications

Product Name Alternative

LRRTM3, UNQ803/PRO1693

UniProt

Q86VH5

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with LRRTM3 Rabbit Polyclonal Antibody (orb586388) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QLQQRSLMRRHRKKKRQSLKQMTPSTQEFYVDYKPTNTETSEMLLNGTGP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human Reg1A Protein CF
9745-RE-050 50 µg

Recombinant Human Reg1A Protein CF

Sign In for Pricing
View Details
Apolipoprotein CIII/APOC3 Rabbit Polyclonal Antibody (Cy3)
orb2570467 100 µg

Apolipoprotein CIII/APOC3 Rabbit Polyclonal Antibody (Cy3)

Sign In for Pricing
View Details
Rabbit Anti-TTR/Prealbumin antibody
SL0152R-01 50 µL

Rabbit Anti-TTR/Prealbumin antibody

Sign In for Pricing
View Details
Rabbit Anti-TTR/Prealbumin antibody
SL0152R-02 100 µL

Rabbit Anti-TTR/Prealbumin antibody

Sign In for Pricing
View Details
Rabbit Anti-TTR/Prealbumin antibody
SL0152R-03 200 µL

Rabbit Anti-TTR/Prealbumin antibody

Sign In for Pricing
View Details
TRAIL R2/DR5/TNFRSF10B Protein, Human, Recombinant
TMPS-00158-01 5 µg

TRAIL R2/DR5/TNFRSF10B Protein, Human, Recombinant

Sign In for Pricing
View Details