Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PPM1H Peptide - N-terminal region

PPM1H Peptide - N-terminal region

Product Specifications

Product Name Alternative

PPM1H, ARHCL1, KIAA1157, URCC2

UniProt

Q9ULR3

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PPM1H Rabbit Polyclonal Antibody (orb586508) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_065751

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GAVTSTPNRNSSKRRSSLPNGEGLQLKENSESEGVSCHYWSLFDGHAGSG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human TASOR activation kit by CRISPRa
GA108181 1 Kit

Human TASOR activation kit by CRISPRa

Sign In for Pricing
View Details
RNF222 (NM_001146684) Human Over-expression Lysate
LY431178 100 µg

RNF222 (NM_001146684) Human Over-expression Lysate

Sign In for Pricing
View Details
Tissue FFPE Sections, Uterus
CS804506 5x 5 µm

Tissue FFPE Sections, Uterus

Sign In for Pricing
View Details
Recombinant Human ITGAX & ITGB2 Heterodimer Protein
PKSH030481-01 100 µg

Recombinant Human ITGAX & ITGB2 Heterodimer Protein

Sign In for Pricing
View Details
Recombinant Human ITGAX & ITGB2 Heterodimer Protein
PKSH030481-02 1 mg

Recombinant Human ITGAX & ITGB2 Heterodimer Protein

Sign In for Pricing
View Details
IDH1 (IDH1/1152), CF568 conjugate, 0.1mg/mL
BNC681152-500 1x 500 µL

IDH1 (IDH1/1152), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details