Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KRT17 Peptide - C-terminal region

KRT17 Peptide - C-terminal region

Product Specifications

Product Name Alternative

KRT17

UniProt

Q04695

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with KRT17 Rabbit Polyclonal Antibody (orb587862) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_000413

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EMDAAPGVDLSRILNEMRDQYEKMAEKNRKDAEDWFFSKTEELNREVATN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Diclofenac-13C6 (may contain up to 3% unlabelled)
TRC-D436449-1MG 1 mg

Diclofenac-13C6 (may contain up to 3% unlabelled)

Sign In for Pricing
View Details
Recombinant TXNDC9 Antibody
RC-5450-01 50 μL

Recombinant TXNDC9 Antibody

Sign In for Pricing
View Details
Recombinant TXNDC9 Antibody
RC-5450-02 100 µL

Recombinant TXNDC9 Antibody

Sign In for Pricing
View Details
Recombinant TXNDC9 Antibody
RC-5450-03 1 mL

Recombinant TXNDC9 Antibody

Sign In for Pricing
View Details
Pyrasulfotole
TRC-P847008-50MG 50 mg

Pyrasulfotole

Sign In for Pricing
View Details
Recombinant Human LYPLA2 Protein (His Tag)
PKSH033332-01 10 µg

Recombinant Human LYPLA2 Protein (His Tag)

Sign In for Pricing
View Details