Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KRT17 Peptide - C-terminal region

KRT17 Peptide - C-terminal region

Product Specifications

Product Name Alternative

KRT17

UniProt

Q04695

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with KRT17 Rabbit Polyclonal Antibody (orb587862) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_000413

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EMDAAPGVDLSRILNEMRDQYEKMAEKNRKDAEDWFFSKTEELNREVATN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CF®505 F (ab') 2 fragment of Goat Anti-Mouse IgG (H+L), 2 mg/mL
#20916-250uL 1x 250 µL

CF®505 F (ab') 2 fragment of Goat Anti-Mouse IgG (H+L), 2 mg/mL

Sign In for Pricing
View Details
Recombinant Human GAD67/GAD1 Protein (His Tag)
PKSH030814 50 µg

Recombinant Human GAD67/GAD1 Protein (His Tag)

Sign In for Pricing
View Details
Tissue FFPE Sections, Fallopian tube
CS709681 5x 5 µm

Tissue FFPE Sections, Fallopian tube

Sign In for Pricing
View Details
Agarose LE, Ultra-Pure Molecular Biology Grade, 500 g
#41028-500G 1x 500 g

Agarose LE, Ultra-Pure Molecular Biology Grade, 500 g

Sign In for Pricing
View Details
Manual Pipette Controller BPIP-404
BPIP-404 1 Unit

Manual Pipette Controller BPIP-404

Sign In for Pricing
View Details
CD43 (DF-T1), Biotin conjugate, 0.1mg/mL
BNCB0027-100 1x 100 µL

CD43 (DF-T1), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details