Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AUH Peptide - C-terminal region

AUH Peptide - C-terminal region

Product Specifications

Product Name Alternative

AUH

UniProt

Q13825

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with AUH Rabbit Polyclonal Antibody (orb587867) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

XP_005252125

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KLAINQGMEVDLVTGLAIEEACYAQTIPTKDRLEGLLAFKEKRPPRYKGE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IQGAP2 Antibody
KC-8989-01 50 μL

IQGAP2 Antibody

Sign In for Pricing
View Details
IQGAP2 Antibody
KC-8989-02 100 µL

IQGAP2 Antibody

Sign In for Pricing
View Details
IQGAP2 Antibody
KC-8989-03 1 mL

IQGAP2 Antibody

Sign In for Pricing
View Details
Slc22a20 Mouse Gene Knockout Kit (CRISPR)
KN515931 1 Kit

Slc22a20 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human MUC1 (Mucin 1) ELISA Kit
E-EL-H0616-01 24 Tests

Human MUC1 (Mucin 1) ELISA Kit

Sign In for Pricing
View Details
Human MUC1 (Mucin 1) ELISA Kit
E-EL-H0616-02 48 Tests

Human MUC1 (Mucin 1) ELISA Kit

Sign In for Pricing
View Details