Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AUH Peptide - C-terminal region

AUH Peptide - C-terminal region

Product Specifications

Product Name Alternative

AUH

UniProt

Q13825

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with AUH Rabbit Polyclonal Antibody (orb587867) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

XP_005252125

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KLAINQGMEVDLVTGLAIEEACYAQTIPTKDRLEGLLAFKEKRPPRYKGE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Repulsive guidance molecule A Antibody
KC-26586-01 50 μL

Repulsive guidance molecule A Antibody

Sign In for Pricing
View Details
Repulsive guidance molecule A Antibody
KC-26586-02 100 µL

Repulsive guidance molecule A Antibody

Sign In for Pricing
View Details
Repulsive guidance molecule A Antibody
KC-26586-03 1 mL

Repulsive guidance molecule A Antibody

Sign In for Pricing
View Details
GEF H1 (ARHGEF2) Rabbit Polyclonal Antibody
AP20505PU-N 100 µg

GEF H1 (ARHGEF2) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Acetohydrazide-D3
TRC-A163772-10MG 10 mg

Acetohydrazide-D3

Sign In for Pricing
View Details
2,4-Dichloro-1,3,5-triazine
TRC-D435995-5G 5 g

2,4-Dichloro-1,3,5-triazine

Sign In for Pricing
View Details