EZH1 Peptide - C-terminal region
EZH1 Peptide - C-terminal region
Product Specifications
Product Name Alternative
EZH1, KIAA0388
UniProt
Q92800
Field of Research
Epigenetics & Chromatin
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with EZH1 Rabbit Polyclonal Antibody (orb331402) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: DVAGWGTFIKESVQKNEFISEYCGELISQDEADRRGKVYDKYMSSFLFNL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
#92231 1 Kit
Mix-n-StainTM CF®405S Antibody Labeling Kit, 1x (50-100ug) labeling
Sign In for Pricing
View Details 
