EZH1 Peptide - C-terminal region
EZH1 Peptide - C-terminal region
Product Specifications
Product Name Alternative
EZH1, KIAA0388
UniProt
Q92800
Field of Research
Epigenetics & Chromatin
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with EZH1 Rabbit Polyclonal Antibody (orb331402) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: DVAGWGTFIKESVQKNEFISEYCGELISQDEADRRGKVYDKYMSSFLFNL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
#20918-250uL 1x 250 µL
CF®660C F (ab') 2 fragment of Goat Anti-Mouse IgG (H+L), 2 mg/mL
Sign In for Pricing
View Details 
![P4HB Recombinant Rabbit Monoclonal Antibody [JE54-98]](https://cdn.genprice.uk/products/992/68dd1c8e061270361ea8249e/imageurl/et7110-92.webp)
ET7110-92 100 µL
P4HB Recombinant Rabbit Monoclonal Antibody [JE54-98]
Sign In for Pricing
View Details