MAP2 Peptide - N-terminal region
MAP2 Peptide - N-terminal region
Product Specifications
Product Name Alternative
MAP2
UniProt
P11137
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with MAP2 Rabbit Polyclonal Antibody (orb587889) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: TPSTAEPSDQKEKESEKQSKPGEDLKHAALVSQPETTKTYPDKKDMQGTE
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
207852-APC 100 µL
PRKAB1 (Protein Kinase, AMP-activated, beta 1 non-Catalytic Subunit, 5'-AMP-activated Protein Kinase beta-1 Subunit, AMP-activated Protein Kinase beta 1 non-Catalytic Subunit, AMP-activated Protein Kinase beta Subunit, AMPK beta -1 Chain, AMPK beta 1, Protein Kinase, AMP-activated, nonCatalytic, AMPK, HAMPKb, MGC17785) (APC)
Sign In for Pricing
View Details 