SP100 Peptide - middle region
SP100 Peptide - middle region
Product Specifications
Product Name Alternative
SP100
UniProt
P23497
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with SP100 Rabbit Polyclonal Antibody (orb587905) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_003104
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: IIVISSEDSEGSTDVDEPLEVFISAPRSEPVINNDNPLESNDEKEGQEAT
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS1103454-01 0.02 mg (E-Coli)
Recombinant Arabidopsis thaliana Gibberellin-regulated protein 11 (GASA11)
Sign In for Pricing
View Details MBS1103454-02 0.1 mg (E-Coli)
Recombinant Arabidopsis thaliana Gibberellin-regulated protein 11 (GASA11)
Sign In for Pricing
View Details MBS1103454-03 0.02 mg (Yeast)
Recombinant Arabidopsis thaliana Gibberellin-regulated protein 11 (GASA11)
Sign In for Pricing
View Details MBS1103454-04 0.1 mg (Yeast)
Recombinant Arabidopsis thaliana Gibberellin-regulated protein 11 (GASA11)
Sign In for Pricing
View Details