Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SP100 Peptide - middle region

SP100 Peptide - middle region

Product Specifications

Product Name Alternative

SP100

UniProt

P23497

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SP100 Rabbit Polyclonal Antibody (orb587905) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_003104

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: IIVISSEDSEGSTDVDEPLEVFISAPRSEPVINNDNPLESNDEKEGQEAT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HIRIP3 Rabbit Polyclonal Antibody (PE)
orb494810 100 µL

HIRIP3 Rabbit Polyclonal Antibody (PE)

Sign In for Pricing
View Details
CPNE9 Protein Vector (Mouse) (pPM-C-HA)
PV167740 500 ng

CPNE9 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
SLC11A1 Protein Vector (Rat) (pPB-N-His)
PV305187 500 ng

SLC11A1 Protein Vector (Rat) (pPB-N-His)

Sign In for Pricing
View Details
Anti-SAH/ACSM3 Antibody Picoband®, Carrier-free
A08748-3-carrier-free 100 µg/Vial

Anti-SAH/ACSM3 Antibody Picoband®, Carrier-free

Sign In for Pricing
View Details
Mouse Gm30172 Pre-designed siRNA Set B
SI105547B 1 Each

Mouse Gm30172 Pre-designed siRNA Set B

Sign In for Pricing
View Details
GW 405833
M20934-01 1 g

GW 405833

Sign In for Pricing
View Details