Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CRADD Peptide - middle region

CRADD Peptide - middle region

Product Specifications

Product Name Alternative

CRADD, RAIDD

UniProt

P78560

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CRADD Rabbit Polyclonal Antibody (orb587948) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_003796

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PAGDRLTGIPSHILNSSPSDRQINQLAQRLGPEWEPMVLSLGLSQTDIYR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PTPH1 (PTPN3) Human Gene Knockout Kit (CRISPR)
KN415851 1 Kit

PTPH1 (PTPN3) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
ENOX1 (NM_001127615) Human Over-expression Lysate
LY426824 100 µg

ENOX1 (NM_001127615) Human Over-expression Lysate

Sign In for Pricing
View Details
C15orf39 Human Gene Knockout Kit (CRISPR)
KN402301 1 Kit

C15orf39 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
H-Ala-2-CT Polystyrene Resin
H0751503301.25G 25 g

H-Ala-2-CT Polystyrene Resin

Sign In for Pricing
View Details
Alkaline Phosphatase Conjugated Robinia pseudoacacia (Black Locust) -RPA-
LA-4101-1 1 mg

Alkaline Phosphatase Conjugated Robinia pseudoacacia (Black Locust) -RPA-

Sign In for Pricing
View Details
Recombinant Mouse CTLA4 Protein (His Tag)
PKSM041001-01 10 µg

Recombinant Mouse CTLA4 Protein (His Tag)

Sign In for Pricing
View Details