Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CRADD Peptide - middle region

CRADD Peptide - middle region

Product Specifications

Product Name Alternative

CRADD, RAIDD

UniProt

P78560

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CRADD Rabbit Polyclonal Antibody (orb587948) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_003796

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PAGDRLTGIPSHILNSSPSDRQINQLAQRLGPEWEPMVLSLGLSQTDIYR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ki-67 (Proliferating Cell Marker) (MKI67/2466), Biotin conjugate, 0.1mg/mL
BNCB2466-100 1x 100 µL

Ki-67 (Proliferating Cell Marker) (MKI67/2466), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ABCC6P1 Human qPCR Primer Pair (NR_003569)
HP220541 200 Reactions

ABCC6P1 Human qPCR Primer Pair (NR_003569)

Sign In for Pricing
View Details
RHBDD2 (NM_001040456) Human Over-expression Lysate
LC421772 20 µg

RHBDD2 (NM_001040456) Human Over-expression Lysate

Sign In for Pricing
View Details
Human TIP49A (RUVBL1) activation kit by CRISPRa
GA105697 1 Kit

Human TIP49A (RUVBL1) activation kit by CRISPRa

Sign In for Pricing
View Details
Anti-Mouse CD8a (53-6.7) In Vivo Antibody - Low Endotoxin
ICH1044-5mg 5 mg

Anti-Mouse CD8a (53-6.7) In Vivo Antibody - Low Endotoxin

Sign In for Pricing
View Details
Human CXCL17 activation kit by CRISPRa
GA117124 1 Kit

Human CXCL17 activation kit by CRISPRa

Sign In for Pricing
View Details