Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MKLN1 Peptide - N-terminal region

MKLN1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

MKLN1

UniProt

Q9UL63

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MKLN1 Rabbit Polyclonal Antibody (orb588003) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GGAVAAAPECRLLPYALHKWSSFSSTYLPENILVDKPNDQSSRWSSESNY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SOX2 (Embryonic Stem Cell Marker) (SOX2/3811R), CF405S conjugate, 0.1mg/mL
BNC043811-100 1x 100 µL

SOX2 (Embryonic Stem Cell Marker) (SOX2/3811R), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Annexin A6 Antibody
8C0126-AAT 50 µg

Annexin A6 Antibody

Sign In for Pricing
View Details
Padi2 Mouse Gene Knockout Kit (CRISPR)
KN312746LP 1 Kit

Padi2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Agmatine Sulfate
TRC-A426900-1G 1 g

Agmatine Sulfate

Sign In for Pricing
View Details
(-)-Ethyl L-Lactate
TRC-E921970-1G 1 g

(-)-Ethyl L-Lactate

Sign In for Pricing
View Details
C1orf175 Mouse Monoclonal Antibody [A5-D4-A6]
M1011-1 100 µL

C1orf175 Mouse Monoclonal Antibody [A5-D4-A6]

Sign In for Pricing
View Details