Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MKLN1 Peptide - N-terminal region

MKLN1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

MKLN1

UniProt

Q9UL63

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MKLN1 Rabbit Polyclonal Antibody (orb588003) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GGAVAAAPECRLLPYALHKWSSFSSTYLPENILVDKPNDQSSRWSSESNY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FRA2 (FOSL2) Mouse Monoclonal Antibody [Clone ID: OTI1C6]
CF809663 100 µg

FRA2 (FOSL2) Mouse Monoclonal Antibody [Clone ID: OTI1C6]

Sign In for Pricing
View Details
Tissue Total RNA, Colon
CR563032 5 µg

Tissue Total RNA, Colon

Sign In for Pricing
View Details
CD74 (LN-2 + CLIP/813), 0.2mg/mL
BNUB1207-100 1x 100 µL

CD74 (LN-2 + CLIP/813), 0.2mg/mL

Sign In for Pricing
View Details
Human VN1R5 activation kit by CRISPRa
GA117319 1 Kit

Human VN1R5 activation kit by CRISPRa

Sign In for Pricing
View Details
Recombinant HDAC3 Antibody
RC-4588-01 50 μL

Recombinant HDAC3 Antibody

Sign In for Pricing
View Details
Recombinant HDAC3 Antibody
RC-4588-02 100 µL

Recombinant HDAC3 Antibody

Sign In for Pricing
View Details