Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CDC37 Peptide - middle region

CDC37 Peptide - middle region

Product Specifications

Product Name Alternative

CDC37, CDC37A

UniProt

Q16543

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CDC37 Rabbit Polyclonal Antibody (orb588050) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_008996

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KTEEDSEEVREQKHKTFVEKYEKQIKHFGMLRRWDDSQKYLSDNVHLVCE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CDK7-IN-5
orb1691461 5 mg

CDK7-IN-5

Sign In for Pricing
View Details
Anti-RPL37A Antibody, Rabbit Polyclonal
MBS8109541-01 0.1 mL

Anti-RPL37A Antibody, Rabbit Polyclonal

Sign In for Pricing
View Details
Anti-RPL37A Antibody, Rabbit Polyclonal
MBS8109541-02 5x 0.1 mL

Anti-RPL37A Antibody, Rabbit Polyclonal

Sign In for Pricing
View Details
P73, phosphorylated (Tyr99) (Tumor Protein p73, p53-like Transcription Factor, p53-related Protein TP73) discontinued
P1001-39B 50 µg

P73, phosphorylated (Tyr99) (Tumor Protein p73, p53-like Transcription Factor, p53-related Protein TP73) discontinued

Sign In for Pricing
View Details
DAPK1 Antibody
orb570920-01 50 µg

DAPK1 Antibody

Sign In for Pricing
View Details
DAPK1 Antibody
orb570920-02 100 µg

DAPK1 Antibody

Sign In for Pricing
View Details