Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

G3BP2 Peptide - middle region

G3BP2 Peptide - middle region

Product Specifications

Product Name Alternative

G3BP2, KIAA0660

UniProt

Q9UN86

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with G3BP2 Rabbit Polyclonal Antibody (orb588053) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QRPRERPGFPPRGPRPGRGDMEQNDSDNRRIIRYPDSHQLFVGNLPHDID

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LRRC66 Protein Vector (Human) (pPB-N-His)
PV092555 500 ng

LRRC66 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
pECMV-Alpl-m-FLAG Plasmid
PVT16048 2 µg

pECMV-Alpl-m-FLAG Plasmid

Sign In for Pricing
View Details
Listeriolysin Rabbit Polyclonal Antibody (APC-Cy5.5)
orb2551771 100 µL

Listeriolysin Rabbit Polyclonal Antibody (APC-Cy5.5)

Sign In for Pricing
View Details
PCNA (Proliferating Cell Nuclear Antigen) (MaxLight 490)
P3115-08B-ML490 100 µL

PCNA (Proliferating Cell Nuclear Antigen) (MaxLight 490)

Sign In for Pricing
View Details
ZNF277 cDNA Clone
MBS1267915-01 0.01 mg Plasmid + 0.2 mL Glycerol-Stock

ZNF277 cDNA Clone

Sign In for Pricing
View Details
ZNF277 cDNA Clone
MBS1267915-02 5x 0.01 mg Plasmid + 5x 0.2 mL Glycerol-Stock

ZNF277 cDNA Clone

Sign In for Pricing
View Details