Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

G3BP2 Peptide - middle region

G3BP2 Peptide - middle region

Product Specifications

Product Name Alternative

G3BP2, KIAA0660

UniProt

Q9UN86

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with G3BP2 Rabbit Polyclonal Antibody (orb588053) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QRPRERPGFPPRGPRPGRGDMEQNDSDNRRIIRYPDSHQLFVGNLPHDID

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Apolipo A-I/ApoAI Protein (N-His, Human)
P513238 100 µg

Apolipo A-I/ApoAI Protein (N-His, Human)

Sign In for Pricing
View Details
CD31 Recombinant Rabbit mAb
BS45621-01 50 µL

CD31 Recombinant Rabbit mAb

Sign In for Pricing
View Details
CD31 Recombinant Rabbit mAb
BS45621-02 100 µL

CD31 Recombinant Rabbit mAb

Sign In for Pricing
View Details
SERHL2 Polyclonal Antibody
A67190-020 20 µL

SERHL2 Polyclonal Antibody

Sign In for Pricing
View Details
Klk6 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
25840114 3x 1.0 µg

Klk6 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
ZNHIT1 Rabbit pAb
E2123618 100 µL

ZNHIT1 Rabbit pAb

Sign In for Pricing
View Details