Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NDUFA4 Peptide - middle region

NDUFA4 Peptide - middle region

Product Specifications

Product Name Alternative

NDUFA4

UniProt

O00483

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NDUFA4 Rabbit Polyclonal Antibody (orb588058) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_002480

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: YLLRLALFNPDVCWDRNNPEPWNKLGPNDQYKFYSVNVDYSKLKKERPDF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Anxa7 activation kit by CRISPRa
GA200197 1 Kit

Mouse Anxa7 activation kit by CRISPRa

Sign In for Pricing
View Details
Cidec Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
16188061 1.0 µg DNA

Cidec Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Klk8 sgRNA CRISPR Lentivector (Rat) (Target 3)
K6583004 1.0 µg DNA

Klk8 sgRNA CRISPR Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details
CSHMT HDR Plasmid (h)
sc-403678-HDR 20 µg

CSHMT HDR Plasmid (h)

Sign In for Pricing
View Details
Tie2 (phospho-Tyr992) rabbit pAb
RA30479-01 50 µL

Tie2 (phospho-Tyr992) rabbit pAb

Sign In for Pricing
View Details
Tie2 (phospho-Tyr992) rabbit pAb
RA30479-02 100 µL

Tie2 (phospho-Tyr992) rabbit pAb

Sign In for Pricing
View Details