Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NDUFA4 Peptide - middle region

NDUFA4 Peptide - middle region

Product Specifications

Product Name Alternative

NDUFA4

UniProt

O00483

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NDUFA4 Rabbit Polyclonal Antibody (orb588058) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_002480

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: YLLRLALFNPDVCWDRNNPEPWNKLGPNDQYKFYSVNVDYSKLKKERPDF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal V1a Vasopressin R/AVPR1A Antibody (612130) [Janelia Fluor 585]
FAB10932JF585 0.1 mL

Mouse Monoclonal V1a Vasopressin R/AVPR1A Antibody (612130) [Janelia Fluor 585]

Sign In for Pricing
View Details
Human Myelin Basic Protein
MBS141868-01 0.25 mg

Human Myelin Basic Protein

Sign In for Pricing
View Details
Human Myelin Basic Protein
MBS141868-02 0.5 mg

Human Myelin Basic Protein

Sign In for Pricing
View Details
Human Myelin Basic Protein
MBS141868-03 1 mg

Human Myelin Basic Protein

Sign In for Pricing
View Details
Human Myelin Basic Protein
MBS141868-04 5x 1 mg

Human Myelin Basic Protein

Sign In for Pricing
View Details
DOG-1 Antibody Cocktail
V3159SAF-100UG 100 µg

DOG-1 Antibody Cocktail

Sign In for Pricing
View Details