Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

REV1 Peptide - C-terminal region

REV1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

REV1, REV1L

UniProt

Q9UBZ9

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with REV1 Rabbit Polyclonal Antibody (orb327223) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

XP_005264024

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: INLIALPAFSQVDPEVFAALPAELQRELKAAYDQRQRQGENSTHQQSASA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PER3 Polyclonal Antibody
E-AB-52923-01 20 µL

PER3 Polyclonal Antibody

Sign In for Pricing
View Details
PER3 Polyclonal Antibody
E-AB-52923-02 60 µL

PER3 Polyclonal Antibody

Sign In for Pricing
View Details
PER3 Polyclonal Antibody
E-AB-52923-03 120 µL

PER3 Polyclonal Antibody

Sign In for Pricing
View Details
PER3 Polyclonal Antibody
E-AB-52923-04 200 µL

PER3 Polyclonal Antibody

Sign In for Pricing
View Details
Diclofenac Ethyl Ester
TRC-D436495-50MG 50 mg

Diclofenac Ethyl Ester

Sign In for Pricing
View Details
VX-765
TRC-V900600-5MG 5 mg

VX-765

Sign In for Pricing
View Details