REV1 Peptide - C-terminal region
REV1 Peptide - C-terminal region
Product Specifications
Product Name Alternative
REV1, REV1L
UniProt
Q9UBZ9
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with REV1 Rabbit Polyclonal Antibody (orb327223) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
XP_005264024
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: INLIALPAFSQVDPEVFAALPAELQRELKAAYDQRQRQGENSTHQQSASA
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![Apg3 (ATG3) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3H2]](https://cdn.genprice.uk/products/937/6868c34d994c49e6dc3f387e/imageurl/ta503346am.webp)
TA503346AM 100 µL
Apg3 (ATG3) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3H2]
Sign In for Pricing
View Details 
TRC-A633025-500MG 500 mg
3-(Aminosulfonyl)thiophene-2-carboxylic Acid
Sign In for Pricing
View Details 
GAF-462-15 1 mL
Colloidal Gold Conjugated Goat Affinity Purified Antibody to Rat IgG (min.x Hu., Bov., Eq.), 15nm
Sign In for Pricing
View Details 
