Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

REV1 Peptide - C-terminal region

REV1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

REV1, REV1L

UniProt

Q9UBZ9

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with REV1 Rabbit Polyclonal Antibody (orb327223) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

XP_005264024

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: INLIALPAFSQVDPEVFAALPAELQRELKAAYDQRQRQGENSTHQQSASA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Calbindin 1 (CALB1) (CALB1/3333), CF405S conjugate, 0.1mg/mL
BNC043333-500 1x 500 µL

Calbindin 1 (CALB1) (CALB1/3333), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Spriomesifen-d9
TRC-S683506-2.5MG 2.5 mg

Spriomesifen-d9

Sign In for Pricing
View Details
Spermidine Trihydrochloride
TRC-S680408-500MG 500 mg

Spermidine Trihydrochloride

Sign In for Pricing
View Details
UBA3 Mouse Monoclonal Antibody [1B6-6-5]
EM1901-64 100 µL

UBA3 Mouse Monoclonal Antibody [1B6-6-5]

Sign In for Pricing
View Details
3-Guanidinopropionic Acid-D4
TRC-G820985-100MG 100 mg

3-Guanidinopropionic Acid-D4

Sign In for Pricing
View Details
SHANK2 (NM_012309) Human Over-expression Lysate
LC432460 20 µg

SHANK2 (NM_012309) Human Over-expression Lysate

Sign In for Pricing
View Details