Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SDHD Peptide - N-terminal region

SDHD Peptide - N-terminal region

Product Specifications

Product Name Alternative

SDHD, SDH4

UniProt

O14521

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SDHD Rabbit Polyclonal Antibody (orb588059) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_002993

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AHISAFLQDRPIPEWCGVQHIHLSPSHHSGSKAASLHWTSERVVSVLLLG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

iCRT-14
TRC-I163900-10MG 10 mg

iCRT-14

Sign In for Pricing
View Details
ARHGAP25 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3G1]
TA501749AM 100 µL

ARHGAP25 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3G1]

Sign In for Pricing
View Details
SET Polyclonal Antibody
E-AB-61834-01 60 µL

SET Polyclonal Antibody

Sign In for Pricing
View Details
SET Polyclonal Antibody
E-AB-61834-02 120 µL

SET Polyclonal Antibody

Sign In for Pricing
View Details
SET Polyclonal Antibody
E-AB-61834-03 200 µL

SET Polyclonal Antibody

Sign In for Pricing
View Details
HSP27 (HSPB1/774), CF568 conjugate, 0.1mg/mL
BNC680774-500 1x 500 µL

HSP27 (HSPB1/774), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details