Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SDHD Peptide - N-terminal region

SDHD Peptide - N-terminal region

Product Specifications

Product Name Alternative

SDHD, SDH4

UniProt

O14521

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SDHD Rabbit Polyclonal Antibody (orb588059) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_002993

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AHISAFLQDRPIPEWCGVQHIHLSPSHHSGSKAASLHWTSERVVSVLLLG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2-Aminoindole Hydrochloride
TRC-A611707-5G 5 g

2-Aminoindole Hydrochloride

Sign In for Pricing
View Details
Recombinant Mouse Coagulation Factor X/F10 Protein (His Tag)
PKSM040986-01 10 µg

Recombinant Mouse Coagulation Factor X/F10 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Mouse Coagulation Factor X/F10 Protein (His Tag)
PKSM040986-02 50 µg

Recombinant Mouse Coagulation Factor X/F10 Protein (His Tag)

Sign In for Pricing
View Details
Pyridoxal Isonicotinoyl Hydrazone
TRC-P991723-500MG 500 mg

Pyridoxal Isonicotinoyl Hydrazone

Sign In for Pricing
View Details
Ki-67 (Proliferating Cell Marker) (MKI67/2466), Biotin conjugate, 0.1mg/mL
BNCB2466-500 1x 500 µL

Ki-67 (Proliferating Cell Marker) (MKI67/2466), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
USH1C Mouse Monoclonal Antibody [Clone ID: OTI1H8]
CF812958 100 µg

USH1C Mouse Monoclonal Antibody [Clone ID: OTI1H8]

Sign In for Pricing
View Details