AFF4 Peptide - middle region
AFF4 Peptide - middle region
Product Specifications
Product Name Alternative
AFF4, AF5Q31, MCEF, HSPC092
UniProt
Q9UHB7
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with AFF4 Rabbit Polyclonal Antibody (orb588064) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: SSGTNSSGQRHDRESYNNSGSSSRKKGQHGSEHSKSRSSSPGKPQAVSSL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS6456928-01 0.1 mL
Lhxenopus1 (LIM/Homeoboxenopus Protein Lhxenopus1, LIM Homeoboxenopus Protein 1, Homeoboxenopus Protein Lim-1, Lhxenopus1, Lim-1, Lim1) (MaxLight 550)
Sign In for Pricing
View Details MBS6456928-02 5x 0.1 mL
Lhxenopus1 (LIM/Homeoboxenopus Protein Lhxenopus1, LIM Homeoboxenopus Protein 1, Homeoboxenopus Protein Lim-1, Lhxenopus1, Lim-1, Lim1) (MaxLight 550)
Sign In for Pricing
View Details 
GTR15393878 1 Vial
Lentiviral human STAT2 sgRNA gene knockout kit - Lentiviral human STAT2 sgRNA gene knockout kit (plasmid)
Sign In for Pricing
View Details 
MBS1148240-01 0.02 mg (E-Coli)
Recombinant Mycobacterium smegmatis Pup deamidase/depupylase (dop)
Sign In for Pricing
View Details MBS1148240-02 0.02 mg (Yeast)
Recombinant Mycobacterium smegmatis Pup deamidase/depupylase (dop)
Sign In for Pricing
View Details