AFF4 Peptide - middle region
AFF4 Peptide - middle region
Product Specifications
Product Name Alternative
AFF4, AF5Q31, MCEF, HSPC092
UniProt
Q9UHB7
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with AFF4 Rabbit Polyclonal Antibody (orb588064) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: SSGTNSSGQRHDRESYNNSGSSSRKKGQHGSEHSKSRSSSPGKPQAVSSL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS1304877-01 0.02 mg (E-Coli)
Recombinant Frog virus 3 Uncharacterized protein 018L (FV3-018L)
Sign In for Pricing
View Details MBS1304877-02 0.1 mg (E-Coli)
Recombinant Frog virus 3 Uncharacterized protein 018L (FV3-018L)
Sign In for Pricing
View Details MBS1304877-03 0.02 mg (Yeast)
Recombinant Frog virus 3 Uncharacterized protein 018L (FV3-018L)
Sign In for Pricing
View Details MBS1304877-04 0.1 mg (Yeast)
Recombinant Frog virus 3 Uncharacterized protein 018L (FV3-018L)
Sign In for Pricing
View Details MBS1304877-05 0.02 mg (Baculovirus)
Recombinant Frog virus 3 Uncharacterized protein 018L (FV3-018L)
Sign In for Pricing
View Details MBS1304877-06 1 mg (E-Coli)
Recombinant Frog virus 3 Uncharacterized protein 018L (FV3-018L)
Sign In for Pricing
View Details