ANKRD17 Peptide - N-terminal region
ANKRD17 Peptide - N-terminal region
Product Specifications
Product Name Alternative
ANKRD17, GTAR, KIAA0697
UniProt
O75179
Field of Research
Immunology & Inflammation
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with ANKRD17 Rabbit Polyclonal Antibody (orb588066) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: PRGMVRVCDLLLKKKPPQQQHHKAKRNRTCRPPSSSESSSDSDNSGGGGG
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS1418738-01 0.02 mg (E-Coli)
Recombinant Dictyostelium discoideum Putative uncharacterized protein DDB_G0287573 (DDB_G0287573)
Sign In for Pricing
View Details MBS1418738-02 0.02 mg (Yeast)
Recombinant Dictyostelium discoideum Putative uncharacterized protein DDB_G0287573 (DDB_G0287573)
Sign In for Pricing
View Details MBS1418738-03 0.1 mg (E-Coli)
Recombinant Dictyostelium discoideum Putative uncharacterized protein DDB_G0287573 (DDB_G0287573)
Sign In for Pricing
View Details MBS1418738-04 0.1 mg (Yeast)
Recombinant Dictyostelium discoideum Putative uncharacterized protein DDB_G0287573 (DDB_G0287573)
Sign In for Pricing
View Details MBS1418738-05 0.02 mg (Baculovirus)
Recombinant Dictyostelium discoideum Putative uncharacterized protein DDB_G0287573 (DDB_G0287573)
Sign In for Pricing
View Details MBS1418738-06 0.02 mg (Mammalian-Cell)
Recombinant Dictyostelium discoideum Putative uncharacterized protein DDB_G0287573 (DDB_G0287573)
Sign In for Pricing
View Details