Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NDUFA6 Peptide - N-terminal region

NDUFA6 Peptide - N-terminal region

Product Specifications

Product Name Alternative

NDUFA6, LYRM6, NADHB14

UniProt

P56556

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NDUFA6 Rabbit Polyclonal Antibody (orb585352) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_002481

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VRQATSTASTFVKPIFSRDMNEAKRRVRELYRAWYREVPNTVHQFQLDIT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-TH (Ser31) Rabbit Polyclonal Antibody (BF594)
orb2429514 100 µL

Phospho-TH (Ser31) Rabbit Polyclonal Antibody (BF594)

Sign In for Pricing
View Details
Human TEX43 siRNA
abx936553-01 15 nmol

Human TEX43 siRNA

Sign In for Pricing
View Details
Human TEX43 siRNA
abx936553-02 30 nmol

Human TEX43 siRNA

Sign In for Pricing
View Details
Wilms Tumor Protein (13C17) Rabbit Monoclonal Antibody
E28M4350 100 µL

Wilms Tumor Protein (13C17) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
DDX21 Double Nickase Plasmid (bovine2)
sc-437356-NIC-2 20 µg

DDX21 Double Nickase Plasmid (bovine2)

Sign In for Pricing
View Details
SLC25A24 Protein Vector (Human) (pPM-C-HA)
44006021 500 ng

SLC25A24 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details