Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NDUFA6 Peptide - N-terminal region

NDUFA6 Peptide - N-terminal region

Product Specifications

Product Name Alternative

NDUFA6, LYRM6, NADHB14

UniProt

P56556

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NDUFA6 Rabbit Polyclonal Antibody (orb585352) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_002481

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VRQATSTASTFVKPIFSRDMNEAKRRVRELYRAWYREVPNTVHQFQLDIT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HIGD1A CRISPR Activation Plasmid (m)
sc-425070-ACT 20 µg

HIGD1A CRISPR Activation Plasmid (m)

Sign In for Pricing
View Details
HSD3BP2 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
LV728786 1.0 µg DNA

HSD3BP2 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)

Sign In for Pricing
View Details
NDUFB2 (NM_004546) Human Over-expression Lysate
LC417915 20 µg

NDUFB2 (NM_004546) Human Over-expression Lysate

Sign In for Pricing
View Details
VPS33B Rabbit Polyclonal Antibody (Cy7)
orb1078288 100 µL

VPS33B Rabbit Polyclonal Antibody (Cy7)

Sign In for Pricing
View Details
DEFB108P1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV759901 1.0 µg DNA

DEFB108P1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details
Rabbit Anti MOB4 Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 50% glycerol, pH7.3) (Western Blot,IHC) 120ul
IRBAMLMOB4AP486120UL 120 µL

Rabbit Anti MOB4 Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 50% glycerol, pH7.3) (Western Blot,IHC) 120ul

Sign In for Pricing
View Details