Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MAEA Peptide - N-terminal region

MAEA Peptide - N-terminal region

Product Specifications

Product Name Alternative

MAEA, EMP, HLC10, PIG5

UniProt

Q7L5Y9

Field of Research

Musculoskeletal & Connective Tissue Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MAEA Rabbit Polyclonal Antibody (orb585982) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KAVESIQAEDESAKLCKRRIEHLKEHSSDQPAAASVWKRKRMDRMMVEHL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cd300ld Mouse Gene Knockout Kit (CRISPR)
KN502902 1 Kit

Cd300ld Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CD49b / ITGA2 Rat Monoclonal Antibody [Clone ID: DX5]
AM01268FC-N 100 µg

CD49b / ITGA2 Rat Monoclonal Antibody [Clone ID: DX5]

Sign In for Pricing
View Details
N,N’-Bis[(2-propenyloxy)carbonyl]-L-cystine
TRC-B353560-250MG 250 mg

N,N’-Bis[(2-propenyloxy)carbonyl]-L-cystine

Sign In for Pricing
View Details
Human VEGFR1/FLT1 Antibody Pair Set
E-KAB-0116 50 µL & 100 µg

Human VEGFR1/FLT1 Antibody Pair Set

Sign In for Pricing
View Details
GelRed® Nucleic Acid Gel Stain, 3X in Water
#41001 1x 4 L

GelRed® Nucleic Acid Gel Stain, 3X in Water

Sign In for Pricing
View Details
SPDYE2 (NM_001031618) Human Over-expression Lysate
LY422215 100 µg

SPDYE2 (NM_001031618) Human Over-expression Lysate

Sign In for Pricing
View Details