Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MAEA Peptide - N-terminal region

MAEA Peptide - N-terminal region

Product Specifications

Product Name Alternative

MAEA, EMP, HLC10, PIG5

UniProt

Q7L5Y9

Field of Research

Musculoskeletal & Connective Tissue Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MAEA Rabbit Polyclonal Antibody (orb585982) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KAVESIQAEDESAKLCKRRIEHLKEHSSDQPAAASVWKRKRMDRMMVEHL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

P53 Tumor Suppressor Protein (PAb240), CF405S conjugate, 0.1mg/mL
BNC041634-100 1x 100 µL

P53 Tumor Suppressor Protein (PAb240), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
L-Tyrosine-d4
TRC-T899978-50MG 50 mg

L-Tyrosine-d4

Sign In for Pricing
View Details
SPRED3 (NM_001042522) Human Over-expression Lysate
LY420960 100 µg

SPRED3 (NM_001042522) Human Over-expression Lysate

Sign In for Pricing
View Details
Prolactin Receptor (hPRL Receptor) (rPRLR/742), CF405S conjugate, 0.1mg/mL
BNC043784-500 1x 500 µL

Prolactin Receptor (hPRL Receptor) (rPRLR/742), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
5-Chlorofuran-2-carboxylic Acid
TRC-C368425-2.5G 2.5 g

5-Chlorofuran-2-carboxylic Acid

Sign In for Pricing
View Details
LRRC10 Human Gene Knockout Kit (CRISPR)
KN212671LP 1 Kit

LRRC10 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details