Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GULP1 Peptide - middle region

GULP1 Peptide - middle region

Product Specifications

Product Name Alternative

GULP1, CED6, GULP

UniProt

Q9UBP9

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GULP1 Rabbit Polyclonal Antibody (orb586260) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: HLCYVFDSEKCAEEITLTIGQAFDLAYRKFLESGGKDVETRKQIAGLQKR

More Discoveries

Explore Other Products

Browse additional items from our catalog

LOM612 10mM * 1mL in DMSO
A12343-10mM-D 10 mM x 1mL in DMSO

LOM612 10mM * 1mL in DMSO

Sign In for Pricing
View Details
(+/-)-Homoproline
TRC-H605000-100MG 100 mg

(+/-)-Homoproline

Sign In for Pricing
View Details
Canine Granulysin ELISA Kit
MBS7277593-01 48 Well

Canine Granulysin ELISA Kit

Sign In for Pricing
View Details
Canine Granulysin ELISA Kit
MBS7277593-02 96 Well

Canine Granulysin ELISA Kit

Sign In for Pricing
View Details
Canine Granulysin ELISA Kit
MBS7277593-03 5x 96 Well

Canine Granulysin ELISA Kit

Sign In for Pricing
View Details
Canine Granulysin ELISA Kit
MBS7277593-04 10x 96 Well

Canine Granulysin ELISA Kit

Sign In for Pricing
View Details