Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GULP1 Peptide - middle region

GULP1 Peptide - middle region

Product Specifications

Product Name Alternative

GULP1, CED6, GULP

UniProt

Q9UBP9

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GULP1 Rabbit Polyclonal Antibody (orb586260) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: HLCYVFDSEKCAEEITLTIGQAFDLAYRKFLESGGKDVETRKQIAGLQKR

More Discoveries

Explore Other Products

Browse additional items from our catalog

2-Amino-6- (azetidin-3-yl) pyrimidin-4-ol dihydrochloride
LEC11209-01 50 mg

2-Amino-6- (azetidin-3-yl) pyrimidin-4-ol dihydrochloride

Sign In for Pricing
View Details
2-Amino-6- (azetidin-3-yl) pyrimidin-4-ol dihydrochloride
LEC11209-02 0.5 g

2-Amino-6- (azetidin-3-yl) pyrimidin-4-ol dihydrochloride

Sign In for Pricing
View Details
Activin Receptor Type IIA (ACVR2A) (NM_001616) Human Tagged ORF Clone Lentiviral Particle
RC210227L4V 200 µL

Activin Receptor Type IIA (ACVR2A) (NM_001616) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
ADAMTSL3 (NM_001301110) Human Tagged ORF Clone
RG240197 10 µg

ADAMTSL3 (NM_001301110) Human Tagged ORF Clone

Sign In for Pricing
View Details
Rps25-set siRNA/shRNA/RNAi Lentivector (Mouse)
42282094 4x 500 ng

Rps25-set siRNA/shRNA/RNAi Lentivector (Mouse)

Sign In for Pricing
View Details
Olfr1242 AAV Vector (Mouse) (CMV)
32700104 1 µg

Olfr1242 AAV Vector (Mouse) (CMV)

Sign In for Pricing
View Details