Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DIAPH3 Peptide - N-terminal region

DIAPH3 Peptide - N-terminal region

Product Specifications

Product Name Alternative

DIAPH3, DIAP3

UniProt

Q9NSV4

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DIAPH3 Rabbit Polyclonal Antibody (orb331319) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ILEEVLEALTSAGEEKKIDRFFCIVEGLRHNSVQLQVACMQLINALVTSP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Colon Matched Tumor & Normal Tissue Lysate - (Dry Ice)
NBP2-47078-2Vial 2 Vials

Colon Matched Tumor & Normal Tissue Lysate - (Dry Ice)

Sign In for Pricing
View Details
Clodanolene sodium
orb1740598-01 25 mg

Clodanolene sodium

Sign In for Pricing
View Details
Clodanolene sodium
orb1740598-02 50 mg

Clodanolene sodium

Sign In for Pricing
View Details
Clodanolene sodium
orb1740598-03 100 mg

Clodanolene sodium

Sign In for Pricing
View Details
C2orf27B siRNA Oligos set (Human)
14397171 3x 5 nmol

C2orf27B siRNA Oligos set (Human)

Sign In for Pricing
View Details
Anti-Tau (Phospho-Ser214)
orb1140115 100 µg

Anti-Tau (Phospho-Ser214)

Sign In for Pricing
View Details