Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DIAPH3 Peptide - N-terminal region

DIAPH3 Peptide - N-terminal region

Product Specifications

Product Name Alternative

DIAPH3, DIAP3

UniProt

Q9NSV4

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DIAPH3 Rabbit Polyclonal Antibody (orb331319) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ILEEVLEALTSAGEEKKIDRFFCIVEGLRHNSVQLQVACMQLINALVTSP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frem1 Mouse shRNA Lentiviral Particle (Locus ID 329872)
TL510435V 500 µL Each

Frem1 Mouse shRNA Lentiviral Particle (Locus ID 329872)

Sign In for Pricing
View Details
Factor XIIIa antibody
22995 100 µL

Factor XIIIa antibody

Sign In for Pricing
View Details
Recombinant Nitrobacter hamburgensis Putative arginyl-tRNA--protein transferase (ate)
MBS1443432-01 0.02 mg (E-Coli)

Recombinant Nitrobacter hamburgensis Putative arginyl-tRNA--protein transferase (ate)

Sign In for Pricing
View Details
Recombinant Nitrobacter hamburgensis Putative arginyl-tRNA--protein transferase (ate)
MBS1443432-02 0.1 mg (E-Coli)

Recombinant Nitrobacter hamburgensis Putative arginyl-tRNA--protein transferase (ate)

Sign In for Pricing
View Details
Recombinant Nitrobacter hamburgensis Putative arginyl-tRNA--protein transferase (ate)
MBS1443432-03 0.02 mg (Yeast)

Recombinant Nitrobacter hamburgensis Putative arginyl-tRNA--protein transferase (ate)

Sign In for Pricing
View Details
Recombinant Nitrobacter hamburgensis Putative arginyl-tRNA--protein transferase (ate)
MBS1443432-04 0.1 mg (Yeast)

Recombinant Nitrobacter hamburgensis Putative arginyl-tRNA--protein transferase (ate)

Sign In for Pricing
View Details