GALK2 Peptide - C-terminal region
GALK2 Peptide - C-terminal region
Product Specifications
Product Name Alternative
GALK2, GK2
UniProt
Q01415
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with GALK2 Rabbit Polyclonal Antibody (orb586477) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_002035
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: EDALHPEPYNPEEICRCLGISLEELRTQILSPNTQDVLIFKLYQRAKHVY
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![Neuropeptide Y (NPY) (29-97) Mouse Monoclonal Antibody [Clone ID: 2C10]](https://cdn.genprice.uk/products/937/68dd189d061270361e8fd1e8/imageurl/am31928pu-n.webp)
AM31928PU-N 50 µg
Neuropeptide Y (NPY) (29-97) Mouse Monoclonal Antibody [Clone ID: 2C10]
Sign In for Pricing
View Details 
![PE Syrian Hamster IgG Isotype Control[SHG-1]](https://cdn.genprice.uk/products/763/68dd14a5061270361e7d17a5/imageurl/e-ab-f09762d.webp)
E-AB-F09762D-01 20 Tests
PE Syrian Hamster IgG Isotype Control[SHG-1]
Sign In for Pricing
View Details E-AB-F09762D-02 100 Tests
PE Syrian Hamster IgG Isotype Control[SHG-1]
Sign In for Pricing
View Details E-AB-F09762D-03 2x 100 Tests
PE Syrian Hamster IgG Isotype Control[SHG-1]
Sign In for Pricing
View Details 