Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GALK2 Peptide - C-terminal region

GALK2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

GALK2, GK2

UniProt

Q01415

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GALK2 Rabbit Polyclonal Antibody (orb586477) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_002035

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EDALHPEPYNPEEICRCLGISLEELRTQILSPNTQDVLIFKLYQRAKHVY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Colon: right
CS714598 5x 5 µm

Tissue FFPE Sections, Colon: right

Sign In for Pricing
View Details
CD117 (KIT/983), CF405S conjugate, 0.1mg/mL
BNC040983-100 1x 100 µL

CD117 (KIT/983), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MemBrite® Fix-ST 667/685 Cell Surface Staining Kit, 100 Reactions
#30102-T 1 Kit

MemBrite® Fix-ST 667/685 Cell Surface Staining Kit, 100 Reactions

Sign In for Pricing
View Details
Texas Red® azide *Single Isomer*
484-AAT 5 mg

Texas Red® azide *Single Isomer*

Sign In for Pricing
View Details
(2S)-1-(Benzyloxycarbonyl)azetidine-2-carboxylic acid-d5
TRC-B194114-5MG 5 mg

(2S)-1-(Benzyloxycarbonyl)azetidine-2-carboxylic acid-d5

Sign In for Pricing
View Details
DHTKD1 (Center) Rabbit Polyclonal Antibody
AP51259PU-N 400 µL

DHTKD1 (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details