Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC35B2 Peptide - N-terminal region

SLC35B2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

SLC35B2, PAPST1, PSEC0149

UniProt

Q8TB61

Field of Research

Cancer Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SLC35B2 Rabbit Polyclonal Antibody (orb326605) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LLVQYFRRKNYLETGRGLCFPLVKACVFGNEPKASDEVPLAPRTEAAETT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-TROY (TNFRSF19) Mouse Monoclonal Antibody [Clone ID: OTI1B7]
M06157-1 100 µL

Anti-TROY (TNFRSF19) Mouse Monoclonal Antibody [Clone ID: OTI1B7]

Sign In for Pricing
View Details
RTCD1 3'UTR Lenti-reporter-Luc Vector
42858081 1.0 µg

RTCD1 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
FABP3 Protein Vector (Human) (pPB-N-His)
PV014878 500 ng

FABP3 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
Klhl21 sgRNA CRISPR Lentivector (Mouse) (Target 3)
K4216304 1.0 µg DNA

Klhl21 sgRNA CRISPR Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
Rabbit Polyclonal SCRN2 Antibody [Alexa Fluor 700]
NBP1-77188AF700 0.1 mL

Rabbit Polyclonal SCRN2 Antibody [Alexa Fluor 700]

Sign In for Pricing
View Details
Lentiviral human KLK5 shRNA (UAS) - Lentiviral human KLK5 shRNA (UAS, RFP) plasmid
GTR15320524 1 Vial

Lentiviral human KLK5 shRNA (UAS) - Lentiviral human KLK5 shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details