Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

WDFY2 Peptide - C-terminal region

WDFY2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

WDFY2, WDF2, ZFYVE22

UniProt

Q96P53

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with WDFY2 Rabbit Polyclonal Antibody (orb586582) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_443182

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RQLISCGGDGGIVVWNMDVERQETPEWLDSDSCQKCDQPFFWNFKQMWDS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Clns1a Mouse Gene Knockout Kit (CRISPR)
KN503480 1 Kit

Clns1a Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
WWC1 Antibody
KC-43959-01 50 μL

WWC1 Antibody

Sign In for Pricing
View Details
WWC1 Antibody
KC-43959-02 100 µL

WWC1 Antibody

Sign In for Pricing
View Details
WWC1 Antibody
KC-43959-03 1 mL

WWC1 Antibody

Sign In for Pricing
View Details
PDZ and LIM Domain 1 (CPTC-PDLIM1-1), CF740 conjugate, 0.1mg/mL
BNC742272-500 1x 500 µL

PDZ and LIM Domain 1 (CPTC-PDLIM1-1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Pure Euonymus europaeus Lectin (Spindle Tree) -EEA-
L-4201-5 5 mg

Pure Euonymus europaeus Lectin (Spindle Tree) -EEA-

Sign In for Pricing
View Details